PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013603705.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 260aa    MW: 29642.7 Da    PI: 9.4948
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013603705.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-161764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT +Ed++l+d++  +G g W+t ++  g++R++k+c++rw +yl
   XP_013603705.1 17 RGAWTDQEDKILKDYIMFHGEGKWSTLPNQAGLKRCGKSCRLRWKNYL 64
                     89********************************************97 PP

2Myb_DNA-binding52.41.2e-1670114147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ + +E+el+++++++lG++ W++Ia +++ gRt++++k++w++ 
   XP_013603705.1  70 RGNISSDEEELIIRLHNLLGNR-WSLIAGRLP-GRTDNEIKNHWNSN 114
                      78999*****************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-221067IPR009057Homeodomain-like
PROSITE profilePS5129415.3841264IPR017930Myb domain
SuperFamilySSF466894.49E-2815111IPR009057Homeodomain-like
SMARTSM007171.9E-121666IPR001005SANT/Myb domain
PfamPF002493.8E-141764IPR001005SANT/Myb domain
CDDcd001675.29E-91964No hitNo description
PROSITE profilePS5129424.56465119IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2368119IPR009057Homeodomain-like
SMARTSM007172.1E-1569117IPR001005SANT/Myb domain
PfamPF002491.5E-1470114IPR001005SANT/Myb domain
CDDcd001671.31E-1074115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0090379Biological Processsecondary cell wall biogenesis involved in seed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MMRKRESSRV KKEELNRGAW TDQEDKILKD YIMFHGEGKW STLPNQAGLK RCGKSCRLRW  60
KNYLRPGIKR GNISSDEEEL IIRLHNLLGN RWSLIAGRLP GRTDNEIKNH WNSNLRKRLP  120
KSQTNQQKSR KHSNNNNMNK VSVIRPKAIR CPKALTFQKQ SSIGSTSLLT VKENVIDQQA  180
SSPSSLGDLK IDFDKIQSEY LFSDLMDFDG LGCGNVMSLV SSDEVLGDYV SADASCLGNL  240
DLNRPFTSCL QEDCLWDFNC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-271411924128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ7786470.0DQ778647.1 Brassica napus transparent testa 2 family isoform 2 (TT2-2) mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013655059.10.0PREDICTED: transcription factor TT2-like
RefseqXP_013603705.10.0PREDICTED: transcription factor TT2
SwissprotQ9FJA21e-128TT2_ARATH; Transcription factor TT2
TrEMBLA0A0D3DL150.0A0A0D3DL15_BRAOL; Uncharacterized protein
TrEMBLA6XGP00.0A6XGP0_BRANA; Transparent testa 2 family isoform 2
STRINGBra035532.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.11e-129MYB family protein